Busca avançada
Ano de início
Entree

Inativação do vírus Zika mediado por nanopartículas decoradas com peptídeos

Resumo

A proposta aqui descrita tem como objetivo sintetizar nanopartículas de sílica fluorescentes e recobri-las simultaneamente com dois peptídeos distintos, usando sequências de direcionamento para ancorar essas biomoléculas funcionais à superfície das nanopartículas. O primeiro é um peptídeo zwitteriônico com uma sequência terminal RERERE, para conferir estabilidade coloidal e evitar a formação de "protein corona" sobre as partículas. O segundo é um peptídeo de direcionamento de sequência MAVLGDTAWDFGSVGGALNSLGKGIHQIFGAAF, que deverá induzir a interação entre as nanopartículas e vírus Zika, consequentemente, inativando a capacidade viral de infectar células saudáveis. A atividade biológica das partículas sintetizadas será testada contra vírus Zika nativo. (AU)

Matéria(s) publicada(s) na Agência FAPESP sobre o auxílio:
Matéria(s) publicada(s) em Outras Mídias (0 total):
Mais itensMenos itens
VEICULO: TITULO (DATA)
VEICULO: TITULO (DATA)